PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040139
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 213aa    MW: 24107.4 Da    PI: 9.555
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040139genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-181865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv+ ++  G  +Wk+ ++  g++R++k+c++rw +yl
      Lus10040139 18 KGPWTAEEDEKLVHFITNNGHTNWKSLPKLAGLNRCGKSCRLRWTNYL 65
                     79********************************************97 PP

2Myb_DNA-binding53.94.1e-1771115147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ +E+ l+++++  lG++ W++Ia +m+ gRt++++k++++++
      Lus10040139  71 RGKFSDDEERLIINLHSVLGNK-WSRIATHMP-GRTDNEIKNYYNTH 115
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-231268IPR009057Homeodomain-like
PROSITE profilePS5129418.011365IPR017930Myb domain
SuperFamilySSF466891.95E-2916112IPR009057Homeodomain-like
SMARTSM007173.6E-131767IPR001005SANT/Myb domain
PfamPF002491.3E-151865IPR001005SANT/Myb domain
CDDcd001677.07E-112065No hitNo description
PROSITE profilePS5129425.84466120IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-2669120IPR009057Homeodomain-like
SMARTSM007171.1E-1570118IPR001005SANT/Myb domain
PfamPF002492.9E-1571115IPR001005SANT/Myb domain
CDDcd001672.36E-1273116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MARPPCCGED QDDNKVKKGP WTAEEDEKLV HFITNNGHTN WKSLPKLAGL NRCGKSCRLR  60
WTNYLRPDIK RGKFSDDEER LIINLHSVLG NKWSRIATHM PGRTDNEIKN YYNTHIRKKL  120
LQMGIDPQTH KPRTDHLQLN QFLNLSQLIG AAHQLTALFN NNNNMEPQQN LFTQHAVGPP  180
AAAQAQVQVM QNLLNLLNPT SLPLSSMSTQ EG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29181207108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007040637.13e-84Myb domain protein 39, putative
SwissprotQ8GWP05e-74MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A061G6W53e-84A0A061G6W5_THECC; Myb domain protein 39, putative
STRINGPOPTR_0001s02240.15e-82(Populus trichocarpa)
STRINGGLYMA09G33870.11e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.28e-72myb domain protein 9